PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4NG331800.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 193aa    MW: 22439.8 Da    PI: 9.9919
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4NG331800.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.96.3e-29959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krien +nrqvt+skRr+gi+KKA EL vLCda+va+i+fsstgk +e++s
  Pavir.4NG331800.2.p  9 KRIENATNRQVTYSKRRTGIMKKARELTVLCDAQVAIIMFSSTGKYHEFCS 59
                         79***********************************************96 PP

2K-box86.16.9e-2971159189
                K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqe 89 
                          yq++ g+sl+ +++e++q+ l+ Lk+ ++nL++e+R+++GedL+sL++ eL+ Leq+++++lk++R +K++++ +q+e+ +kk  +++ 
  Pavir.4NG331800.2.p  71 YQQAIGTSLWVEQYENMQRTLSHLKDINRNLRTEIRQRMGEDLDSLEFDELRGLEQNVDTALKEVRHRKYHVISTQTETYKKKVIRIKT 159
                          67888999***************************************************************************988775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.6E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.59161IPR002100Transcription factor, MADS-box
CDDcd002652.17E-41280No hitNo description
SuperFamilySSF554551.31E-36295IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-28323IPR002100Transcription factor, MADS-box
PfamPF003192.2E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-283859IPR002100Transcription factor, MADS-box
PfamPF014862.3E-2082156IPR002487Transcription factor, K-box
PROSITE profilePS5129713.32884172IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MGRGKIEIKR IENATNRQVT YSKRRTGIMK KARELTVLCD AQVAIIMFSS TGKYHEFCSP  60
GTDIKTIFDR YQQAIGTSLW VEQYENMQRT LSHLKDINRN LRTEIRQRMG EDLDSLEFDE  120
LRGLEQNVDT ALKEVRHRKY HVISTQTETY KKKVIRIKTS IFQYHHVIPH TLLCIDLLVH  180
FPSQLGNASL KS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D2e-16273170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-16273170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-16273170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A2e-16273170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3mu6_D2e-16263162Myocyte-specific enhancer factor 2A
3mu6_C2e-16263162Myocyte-specific enhancer factor 2A
3mu6_B2e-16263162Myocyte-specific enhancer factor 2A
3mu6_A2e-16263162Myocyte-specific enhancer factor 2A
1tqe_S2e-16173171Myocyte-specific enhancer factor 2B
1tqe_R2e-16173171Myocyte-specific enhancer factor 2B
1tqe_Q2e-16173171Myocyte-specific enhancer factor 2B
1tqe_P2e-16173171Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00077ChIP-seqTransfer from AT3G54340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0189980.0BT018998.1 Zea mays clone Contig486.F mRNA sequence.
GenBankBT0399880.0BT039988.1 Zea mays full-length cDNA clone ZM_BFc0056L03 mRNA, complete cds.
GenBankEU9656570.0EU965657.1 Zea mays clone 287776 MADS-box transcription factor 16 mRNA, complete cds.
GenBankEU9662370.0EU966237.1 Zea mays clone 292756 MADS-box transcription factor 16 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966424.11e-109PREDICTED: MADS-box transcription factor 16
SwissprotQ944S91e-108MAD16_ORYSJ; MADS-box transcription factor 16
TrEMBLK3XZ631e-109K3XZ63_SETIT; Uncharacterized protein
STRINGSi007221m1e-109(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.12e-57MIKC_MADS family protein